Lineage for d5a3ob_ (5a3o B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812045Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 1812046Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 1812047Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 1812048Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 1812049Species Pseudomonas aeruginosa [TaxId:287] [82029] (11 PDB entries)
    Uniprot Q9HYN5 # PA3361
  8. 1812085Domain d5a3ob_: 5a3o B: [275155]
    automated match to d1uzva_
    complexed with ca, cl, dh6, mma

Details for d5a3ob_

PDB Entry: 5a3o (more details), 1.6 Å

PDB Description: crystal structure of the lecb lectin from pseudomonas aeruginosa in complex with methyl 6-(cinnamido)-6-deoxy-alpha-d-mannopyranoside at 1.6 ansgtrom
PDB Compounds: (B:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d5a3ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a3ob_ b.115.1.1 (B:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d5a3ob_:

Click to download the PDB-style file with coordinates for d5a3ob_.
(The format of our PDB-style files is described here.)

Timeline for d5a3ob_: