Lineage for d5a3ie1 (5a3i E:1-321)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776109Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [228148] (4 PDB entries)
  8. 2776114Domain d5a3ie1: 5a3i E:1-321 [275150]
    Other proteins in same PDB: d5a3ia2, d5a3ib_, d5a3ic_, d5a3id1, d5a3id2, d5a3ie2, d5a3if_, d5a3ig_, d5a3ih1, d5a3ih2
    automated match to d1rd8a_
    complexed with nag; mutant

Details for d5a3ie1

PDB Entry: 5a3i (more details), 2.89 Å

PDB Description: crystal structure of a complex formed between fld194 fab and transmissible mutant h5 haemagglutinin
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d5a3ie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a3ie1 b.19.1.2 (E:1-321) automated matches {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d5a3ie1:

Click to download the PDB-style file with coordinates for d5a3ie1.
(The format of our PDB-style files is described here.)

Timeline for d5a3ie1: