SCOPe 2.08: Domain d1a1xa_: 1a1x A:

Lineage for d1a1xa_ (1a1x A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.63: Oncogene products [50903] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.63.1: Oncogene products [50904] (1 family)
   duplication: N- and C-terminal halves are related by pseudo dyad
   automatically mapped to Pfam PF01840

5. Family b.63.1.1: Oncogene products [50905] (2 proteins)

6. Protein p13-MTCP1 [50908] (1 species)
   involved in T cell malignancies

7. Species Human (Homo sapiens) [TaxId:9606] [50909] (3 PDB entries)

8. Domain d1a1xa_: 1a1x A: [27514]

Details for d1a1xa_

PDB Entry: 1a1x, 2 Å

PDB Description: crystal structure of mtcp-1 involved in t cell malignancies

PDB Compounds: (A:) hmtcp-1

SCOPe Domain Sequences for d1a1xa_:

Sequence; same for both SEQRES and ATOM records:

>d1a1xa_ b.63.1.1 (A:) p13-MTCP1 {Human (Homo sapiens) [TaxId: 9606]}
agedvgappdhlwvhqegiyrdeyqrtwvavveeetsflrarvqqiqvplgdaarpshll
tsqlplmwqlypeerymdnnsrlwqiqhhlmvrgvqelllkllpdd

Timeline for d1a1xa_:

• d1a1xa_ first appeared (with stable ids) in SCOP 1.55, called d1a1x__
  
• d1a1xa_ appears in SCOPe 2.07