Lineage for d4zo2b_ (4zo2 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997620Species Chryseobacterium sp. [TaxId:878220] [275132] (2 PDB entries)
  8. 2997622Domain d4zo2b_: 4zo2 B: [275136]
    automated match to d4le6d_
    complexed with zn

Details for d4zo2b_

PDB Entry: 4zo2 (more details), 1.09 Å

PDB Description: aidc, a dizinc quorum-quenching lactonase
PDB Compounds: (B:) Acylhomoserine lactonase

SCOPe Domain Sequences for d4zo2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zo2b_ d.157.1.0 (B:) automated matches {Chryseobacterium sp. [TaxId: 878220]}
ddlsgfkkiklgelelfiltdgyiheenlisfaprgnvaelktilkdnfradhyidmain
illvktkeklilmdtgmgifadertgfllkslqkagfsahditdiflshahpdhiggvvd
kqnklvfpnasifiskiehdfwinasikdfnnsalkahperlnqiipalqnilkaiqpkl
kfydlnktlyshfnfqlapghtpgltvttissgneklmyvadlihsdvilfphpdwgfsg
dtdldiatasrkkflkqladtkaraftshlpwpglgftkvkapgfewipesfmn

SCOPe Domain Coordinates for d4zo2b_:

Click to download the PDB-style file with coordinates for d4zo2b_.
(The format of our PDB-style files is described here.)

Timeline for d4zo2b_: