SCOPe 2.08: Domain d4zo3b_: 4zo3 B:

Lineage for d4zo3b_ (4zo3 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Chryseobacterium sp. [TaxId:878220] [275132] (2 PDB entries)

8. Domain d4zo3b_: 4zo3 B: [275134]
   automated match to d4le6d_
   complexed with c6l, zn

Details for d4zo3b_

PDB Entry: 4zo3, 1.67 Å

PDB Description: aidc, a dizinc quorum-quenching lactonase, in complex with a product n-hexnoyl-l-homoserine

PDB Compounds: (B:) Acylhomoserine lactonase

SCOPe Domain Sequences for d4zo3b_:

Sequence; same for both SEQRES and ATOM records:

>d4zo3b_ d.157.1.0 (B:) automated matches {Chryseobacterium sp. [TaxId: 878220]}
ddlsgfkkiklgelelfiltdgyiheenlisfaprgnvaelktilkdnfradhyidmain
illvktkeklilmdtgmgifadertgfllkslqkagfsahditdiflshahpdhiggvvd
kqnklvfpnasifiskiehdfwinasikdfnnsalkahperlnqiipalqnilkaiqpkl
kfydlnktlyshfnfqlapghtpgltvttissgneklmyvadlihsdvilfphpdwgfsg
dtdldiatasrkkflkqladtkaraftshlpwpglgftkvkapgfewipesfmn

Timeline for d4zo3b_:

• d4zo3b_ first appeared in SCOPe 2.05
  
• d4zo3b_ appears in SCOPe 2.07