Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Chryseobacterium sp. [TaxId:878220] [275132] (2 PDB entries) |
Domain d4zo3b_: 4zo3 B: [275134] automated match to d4le6d_ complexed with c6l, zn |
PDB Entry: 4zo3 (more details), 1.67 Å
SCOPe Domain Sequences for d4zo3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zo3b_ d.157.1.0 (B:) automated matches {Chryseobacterium sp. [TaxId: 878220]} ddlsgfkkiklgelelfiltdgyiheenlisfaprgnvaelktilkdnfradhyidmain illvktkeklilmdtgmgifadertgfllkslqkagfsahditdiflshahpdhiggvvd kqnklvfpnasifiskiehdfwinasikdfnnsalkahperlnqiipalqnilkaiqpkl kfydlnktlyshfnfqlapghtpgltvttissgneklmyvadlihsdvilfphpdwgfsg dtdldiatasrkkflkqladtkaraftshlpwpglgftkvkapgfewipesfmn
Timeline for d4zo3b_: