| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) ![]() |
| Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
| Protein Immunoglobulin-binding protein A modules [46999] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries) |
| Domain d4zncb_: 4znc B: [275129] Other proteins in same PDB: d4zncd1, d4zncd2, d4znce1, d4znce2, d4zncf1, d4zncf2 automated match to d4npda_ mutant |
PDB Entry: 4znc (more details), 2.28 Å
SCOPe Domain Sequences for d4zncb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zncb_ a.8.1.1 (B:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
fnkewqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqap
Timeline for d4zncb_: