SCOPe 2.05: Domain d4ywgl2: 4ywg L:112-215

Lineage for d4ywgl2 (4ywg L:112-215)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4ywgl2: 4ywg L:112-215 [275124]
   automated match to d1dqdl2
   complexed with nag

Details for d4ywgl2

PDB Entry: 4ywg, 3 Å

PDB Description: crystal structure of 830a in complex with v1v2

PDB Compounds: (L:) Light chain of anti-HIV-1 gp120 V1V2 antibody 830A

SCOPe Domain Sequences for d4ywgl2:

Sequence, based on SEQRES records:

>d4ywgl2 b.1.1.0 (L:112-215) automated matches {Homo sapiens [TaxId: 9606]}
apsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskds
tyslsstltlskadyekhkvyacevthqglsspvtksfnrgecs

Sequence, based on observed residues (ATOM records):

>d4ywgl2 b.1.1.0 (L:112-215) automated matches {Homo sapiens [TaxId: 9606]}
apsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskds
tyslsstltlskadyekhkvyacevthqspvtksfnrgecs

Timeline for d4ywgl2:

• d4ywgl2 is new in SCOPe 2.05-stable
  
• d4ywgl2 appears in SCOPe 2.06
  
• d4ywgl2 appears in the current release, SCOPe 2.08