Lineage for d4ywgl2 (4ywg L:112-215)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357579Domain d4ywgl2: 4ywg L:112-215 [275124]
    automated match to d1dqdl2
    complexed with nag

Details for d4ywgl2

PDB Entry: 4ywg (more details), 3 Å

PDB Description: crystal structure of 830a in complex with v1v2
PDB Compounds: (L:) Light chain of anti-HIV-1 gp120 V1V2 antibody 830A

SCOPe Domain Sequences for d4ywgl2:

Sequence, based on SEQRES records: (download)

>d4ywgl2 b.1.1.0 (L:112-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskds
tyslsstltlskadyekhkvyacevthqglsspvtksfnrgecs

Sequence, based on observed residues (ATOM records): (download)

>d4ywgl2 b.1.1.0 (L:112-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskds
tyslsstltlskadyekhkvyacevthqspvtksfnrgecs

SCOPe Domain Coordinates for d4ywgl2:

Click to download the PDB-style file with coordinates for d4ywgl2.
(The format of our PDB-style files is described here.)

Timeline for d4ywgl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ywgl1