SCOPe 2.05: Domain d4z99a_: 4z99 A:

Lineage for d4z99a_ (4z99 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (15 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [275117] (3 PDB entries)

8. Domain d4z99a_: 4z99 A: [275120]
   automated match to d2wjaa_

Details for d4z99a_

PDB Entry: 4z99, 2.3 Å

PDB Description: crystal structure of the apo low molecular weight protein tyrosine phosphatase isoform a

PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d4z99a_:

Sequence; same for both SEQRES and ATOM records:

>d4z99a_ c.44.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
gshmefmaeqatksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeign
ppdyrgqscmkrhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckaki
ellgsydpqkqliiedpyygndsdfetvyqqcvrccraflekah

Timeline for d4z99a_:

• d4z99a_ is new in SCOPe 2.05-stable
  
• d4z99a_ is called d4z99a1 in SCOPe 2.06
  
• d4z99a_ appears in the current release, SCOPe 2.08, called d4z99a1