Lineage for d1clh__ (1clh -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) 
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) 
Protein Bacterial cyclophilin [50901] (1 species) Species Escherichia coli [TaxId:562] [50902] (3 PDB entries) 
Domain d1clh__: 1clh - [27512]
Details for d1clh__
PDB Entry: 1clh (more details)
PDB Description: three-dimensional solution structure of escherichia coli periplasmic cyclophilin
SCOP Domain Sequences for d1clh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clh__ b.62.1.1 (-) Bacterial cyclophilin {Escherichia coli}
akgdphvllttsagnieleldkqkapvsvqnfvdyvnsgfynnttfhrvipgfmiqgggf
teqmqqkkpnppikneadnglrntrgtiamartadkdsatsqffinvadnafldhgqrdf
gyavfgkvvkgmdvadkisqvpthdvgpyqnvpskpvvilsakvlp
SCOP Domain Coordinates for d1clh__:
Click to download the PDB-style file with coordinates for d1clh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1clh__:
- d1clh__ first appeared (with stable ids) in SCOP 1.55
- d1clh__ appears in SCOP 1.59
- d1clh__ appears in the current release, SCOPe 2.08, called d1clha_
View in 3D