SCOPe 2.08: Domain d1clha_: 1clh A:

Lineage for d1clha_ (1clh A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Peptidyl-prolyl cis-trans isomerase A, PpiA [50901] (2 species)

7. Species Escherichia coli [TaxId:562] [50902] (7 PDB entries)
   Uniprot P20752

8. Domain d1clha_: 1clh A: [27512]
   see also PDB entry 1CSA

Details for d1clha_

PDB Entry: 1clh

PDB Description: three-dimensional solution structure of escherichia coli periplasmic cyclophilin

PDB Compounds: (A:) cyclophilin

SCOPe Domain Sequences for d1clha_:

Sequence; same for both SEQRES and ATOM records:

>d1clha_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]}
akgdphvllttsagnieleldkqkapvsvqnfvdyvnsgfynnttfhrvipgfmiqgggf
teqmqqkkpnppikneadnglrntrgtiamartadkdsatsqffinvadnafldhgqrdf
gyavfgkvvkgmdvadkisqvpthdvgpyqnvpskpvvilsakvlp

Timeline for d1clha_:

• d1clha_ first appeared (with stable ids) in SCOP 1.55, called d1clh__
  
• d1clha_ appears in SCOPe 2.07