Lineage for d4z9ba1 (4z9b A:5-157)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454323Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2454324Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2454393Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2454394Protein automated matches [190574] (17 species)
    not a true protein
  7. 2454434Species Human (Homo sapiens) [TaxId:9606] [275117] (3 PDB entries)
  8. 2454437Domain d4z9ba1: 4z9b A:5-157 [275118]
    Other proteins in same PDB: d4z9ba2
    automated match to d2wjaa_
    complexed with b85

Details for d4z9ba1

PDB Entry: 4z9b (more details), 2.41 Å

PDB Description: crystal structure of low molecular weight protein tyrosine phosphatase isoform a complexed with benzylphosphonic acid
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d4z9ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9ba1 c.44.1.0 (A:5-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscmk
rhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqkq
liiedpyygndsdfetvyqqcvrccraflekah

SCOPe Domain Coordinates for d4z9ba1:

Click to download the PDB-style file with coordinates for d4z9ba1.
(The format of our PDB-style files is described here.)

Timeline for d4z9ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z9ba2