SCOPe 2.06: Domain d4z6ja_: 4z6j A:

Lineage for d4z6ja_ (4z6j A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (8 species)
   not a true protein

7. Species Hoeflea phototrophica [TaxId:411684] [275106] (6 PDB entries)

8. Domain d4z6ja_: 4z6j A: [275114]
   automated match to d3szil_

Details for d4z6ja_

PDB Entry: 4z6j, 2.4 Å

PDB Description: crystal structure of apo intact hoefavidin

PDB Compounds: (A:) Avidin family

SCOPe Domain Sequences for d4z6ja_:

Sequence; same for both SEQRES and ATOM records:

>d4z6ja_ b.61.1.0 (A:) automated matches {Hoeflea phototrophica [TaxId: 411684]}
kllagasnwvnqsgsvaqfvftpsptqpqtyevsgnyinnaqgtgckgtpyplsgayysg
nqiisfsvvwsnasancqsatgwtgyfdfsgsqavlktdwnlafysgstpaiqqgqddfm
qsvatvsesllte

Timeline for d4z6ja_:

• d4z6ja_ first appeared in SCOPe 2.05
  
• d4z6ja_ appears in the current release, SCOPe 2.07