Lineage for d2nula_ (2nul A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416464Protein Peptidyl-prolyl cis-trans isomerase A, PpiA [50901] (2 species)
  7. 2416465Species Escherichia coli [TaxId:562] [50902] (7 PDB entries)
    Uniprot P20752
  8. 2416471Domain d2nula_: 2nul A: [27511]

Details for d2nula_

PDB Entry: 2nul (more details), 2.1 Å

PDB Description: peptidylprolyl isomerase from e. coli
PDB Compounds: (A:) peptidylprolyl isomerase

SCOPe Domain Sequences for d2nula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nula_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]}
mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
cvfaevvdgmdvvdkikgvatgrsgmhqdvpkedviiesvtvs

SCOPe Domain Coordinates for d2nula_:

Click to download the PDB-style file with coordinates for d2nula_.
(The format of our PDB-style files is described here.)

Timeline for d2nula_: