Lineage for d2nul__ (2nul -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16874Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 16875Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 16876Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (2 proteins)
  6. 16877Protein Bacterial cyclophilin [50901] (1 species)
  7. 16878Species Escherichia coli [TaxId:562] [50902] (3 PDB entries)
  8. 16880Domain d2nul__: 2nul - [27511]

Details for d2nul__

PDB Entry: 2nul (more details), 2.1 Å

PDB Description: peptidylprolyl isomerase from e. coli

SCOP Domain Sequences for d2nul__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nul__ b.62.1.1 (-) Bacterial cyclophilin {Escherichia coli}
mvtfhtnhgdiviktfddkapetvknfldycregfynntifhrvingfmiqgggfepgmk
qkatkepikneannglkntrgtlamartqaphsataqffinvvdndflnfsgeslqgwgy
cvfaevvdgmdvvdkikgvatgrsgmhqdvpkedviiesvtvs

SCOP Domain Coordinates for d2nul__:

Click to download the PDB-style file with coordinates for d2nul__.
(The format of our PDB-style files is described here.)

Timeline for d2nul__: