Lineage for d4yvga_ (4yvg A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884654Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1884655Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1884718Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
    fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain
  6. 1884731Protein automated matches [196235] (1 species)
    not a true protein
  7. 1884732Species Haemophilus influenzae [TaxId:71421] [196236] (7 PDB entries)
  8. 1884739Domain d4yvga_: 4yvg A: [275101]
    automated match to d1uaja_
    complexed with sam

Details for d4yvga_

PDB Entry: 4yvg (more details), 1.55 Å

PDB Description: crystal structure of h. influenzae trmd in complex with adomet
PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4yvga_:

Sequence, based on SEQRES records: (download)

>d4yvga_ c.116.1.4 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
hmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpg
mlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegid
erliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcp
hytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllke
aqaehns

Sequence, based on observed residues (ATOM records): (download)

>d4yvga_ c.116.1.4 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
hmwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpg
mlmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegid
erliqteideewsigdyvltggelpamtlidavarfipgvldsfadglldcphytrpevl
egltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehns

SCOPe Domain Coordinates for d4yvga_:

Click to download the PDB-style file with coordinates for d4yvga_.
(The format of our PDB-style files is described here.)

Timeline for d4yvga_:

  • d4yvga_ appears in periodic updates to SCOPe 2.05 starting on 2015-07-16
  • d4yvga_ is called d4yvga1 in SCOPe 2.06
  • d4yvga_ appears in the current release, SCOPe 2.07, called d4yvga1