Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (17 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [275090] (1 PDB entry) |
Domain d4y90a_: 4y90 A: [275092] automated match to d3uwva_ complexed with ca, gol, na, so4 |
PDB Entry: 4y90 (more details), 2.1 Å
SCOPe Domain Sequences for d4y90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y90a_ c.1.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]} mqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagiafg gqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqangll pivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktataddaeel aaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvlgml dalr
Timeline for d4y90a_: