Lineage for d4y90a_ (4y90 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815651Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 1815652Protein automated matches [190605] (17 species)
    not a true protein
  7. 1815676Species Deinococcus radiodurans [TaxId:243230] [275090] (1 PDB entry)
  8. 1815677Domain d4y90a_: 4y90 A: [275092]
    automated match to d3uwva_
    complexed with ca, gol, na, so4

Details for d4y90a_

PDB Entry: 4y90 (more details), 2.1 Å

PDB Description: crystal structure of triosephosphate isomerase from deinococcus radiodurans
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4y90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y90a_ c.1.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
mqtllalnwkmnktptearswaeelttkyapaegvdlavlapaldlsalaanlpagiafg
gqdvsahesgaytgeisaamlkdagascvvvghserreyhdesdatvaakarqaqangll
pivcvgenldvrergehvpqtlaqlrgslegvgadvvvayepvwaigtgktataddaeel
aaairgalreqygaraegirvlyggsvkpeniaeicgkpnvngalvggaslkvpdvlgml
dalr

SCOPe Domain Coordinates for d4y90a_:

Click to download the PDB-style file with coordinates for d4y90a_.
(The format of our PDB-style files is described here.)

Timeline for d4y90a_: