SCOPe 2.08: Domain d4xvtl2: 4xvt L:108-216

Lineage for d4xvtl2 (4xvt L:108-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4xvtl2: 4xvt L:108-216 [275086]
   automated match to d4om1l2
   complexed with nag

Details for d4xvtl2

PDB Entry: 4xvt, 1.69 Å

PDB Description: crystal structure of hiv-1 93th057 coree gp120 with antibody 45- vrc01.h01+07.o-863513/45-vrc01.l01+07.o-110653 (vrc07_1995)

PDB Compounds: (L:) 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653 (VRC07_1995) Light chain

SCOPe Domain Sequences for d4xvtl2:

Sequence; same for both SEQRES and ATOM records:

>d4xvtl2 b.1.1.0 (L:108-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglaspvtksfnrgec

Timeline for d4xvtl2:

• d4xvtl2 first appeared in SCOPe 2.05
  
• d4xvtl2 appears in SCOPe 2.07