SCOP 1.75: Domain d1qnha_: 1qnh A:

Lineage for d1qnha_ (1qnh A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (4 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Plasmodium falciparum [TaxId:5833] [50900] (2 PDB entries)

8. Domain d1qnha_: 1qnh A: [27508]

Details for d1qnha_

PDB Entry: 1qnh, 2.1 Å

PDB Description: plasmodium falciparum cyclophilin (double mutant) complexed with cyclosporin a

PDB Compounds: (A:) cyclophilin

SCOP Domain Sequences for d1qnha_:

Sequence; same for both SEQRES and ATOM records:

>d1qnha_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]}
krskvffdisidnsnagriifelfsditprtcenfralctgekigsrgknlhyknsifhr
iipqfmcqggditngngsggesiygrsftdenfnmkhdqpgllsmanagpntnssqflit
lvpcpwldgkhvvfgkviegmnvvremekegaksgyvkrsvvitdcgew

Timeline for d1qnha_:

• d1qnha_ first appeared (with stable ids) in SCOP 1.55
  
• d1qnha_ appears in SCOP 1.73
  
• d1qnha_ appears in SCOPe 2.01
  
• d1qnha_ appears in the current release, SCOPe 2.08