SCOPe 2.08: Domain d4xrcl1: 4xrc L:1-106

Lineage for d4xrcl1 (4xrc L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4xrcl1: 4xrc L:1-106 [275076]
   Other proteins in same PDB: d4xrca2, d4xrcb2, d4xrch2, d4xrcl2
   automated match to d2dd8l1

Details for d4xrcl1

PDB Entry: 4xrc, 2.74 Å

PDB Description: antibody hemagglutinin complexes

PDB Compounds: (L:) H5.3 Fab Light Chain

SCOPe Domain Sequences for d4xrcl1:

Sequence; same for both SEQRES and ATOM records:

>d4xrcl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtvnitcsgdtlgdkyvcwyqqkpgqspvlviyqdtkrpsgiperf
sgsnsgdtatltvsgtqamdeadyycqawdsssfvfgtgtkvtvlg

Timeline for d4xrcl1:

• d4xrcl1 first appeared in SCOPe 2.05
  
• d4xrcl1 appears in SCOPe 2.07