Lineage for d4xnml2 (4xnm L:107-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750961Domain d4xnml2: 4xnm L:107-208 [275071]
    Other proteins in same PDB: d4xnma1, d4xnmb1, d4xnmb2, d4xnmh1, d4xnmh2, d4xnml1
    automated match to d2dd8l2

Details for d4xnml2

PDB Entry: 4xnm (more details), 2.51 Å

PDB Description: antibody influenza h5 complex
PDB Compounds: (L:) H5.3 Fab Light Chain

SCOPe Domain Sequences for d4xnml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xnml2 b.1.1.2 (L:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d4xnml2:

Click to download the PDB-style file with coordinates for d4xnml2.
(The format of our PDB-style files is described here.)

Timeline for d4xnml2: