| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4xnml1: 4xnm L:1-106 [275070] Other proteins in same PDB: d4xnma2, d4xnmb2, d4xnmh2, d4xnml2 automated match to d2dd8l1 |
PDB Entry: 4xnm (more details), 2.51 Å
SCOPe Domain Sequences for d4xnml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xnml1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtvnitcsgdtlgdkyvcwyqqkpgqspvlviyqdtkrpsgiperf
sgsnsgdtatltvsgtqamdeadyycqawdsssfvfgtgtkvtvlg
Timeline for d4xnml1: