SCOPe 2.08: Domain d4xnma2: 4xnm A:107-208

Lineage for d4xnma2 (4xnm A:107-208)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d4xnma2: 4xnm A:107-208 [275069]
Other proteins in same PDB: d4xnma1, d4xnmb1, d4xnmb2, d4xnmh1, d4xnmh2, d4xnml1
automated match to d2dd8l2

Details for d4xnma2

PDB Entry: 4xnm (more details), 2.51 Å

PDB Description: antibody influenza h5 complex

PDB Compounds: (A:) H5.3 Fab Light Chain

SCOPe Domain Sequences for d4xnma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xnma2 b.1.1.2 (A:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d4xnma2:

Click to download the PDB-style file with coordinates for d4xnma2.
(The format of our PDB-style files is described here.)

Timeline for d4xnma2: