SCOPe 2.08: Domain d4xnqa1: 4xnq A:1-106

Lineage for d4xnqa1 (4xnq A:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4xnqa1: 4xnq A:1-106 [275066]
   Other proteins in same PDB: d4xnqa2, d4xnqb2, d4xnqh2, d4xnql2
   automated match to d2dd8l1

Details for d4xnqa1

PDB Entry: 4xnq, 2 Å

PDB Description: antibody hemagglutinin complexes

PDB Compounds: (A:) H5.3 Light chain

SCOPe Domain Sequences for d4xnqa1:

Sequence; same for both SEQRES and ATOM records:

>d4xnqa1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeltqppsvsvspgqtvnitcsgdtlgdkyvcwyqqkpgqspvlviyqdtkrpsgiperf
sgsnsgdtatltvsgtqamdeadyycqawdsssfvfgtgtkvtvlg

Timeline for d4xnqa1:

• d4xnqa1 first appeared in SCOPe 2.05
  
• d4xnqa1 appears in SCOPe 2.07