Lineage for d4xroa2 (4xro A:148-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706649Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [273803] (5 PDB entries)
  8. 2706651Domain d4xroa2: 4xro A:148-219 [275065]
    Other proteins in same PDB: d4xroa1
    automated match to d2m8pa2

Details for d4xroa2

PDB Entry: 4xro (more details), 2.01 Å

PDB Description: disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i)
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4xroa2:

Sequence, based on SEQRES records: (download)

>d4xroa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
tsildirqgpkepfrdyidrfyktiraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d4xroa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
tsildirqgpkepfrdyidrfyktiraeqatetllvqnanpdcktilkalgpgatleemm
tacq

SCOPe Domain Coordinates for d4xroa2:

Click to download the PDB-style file with coordinates for d4xroa2.
(The format of our PDB-style files is described here.)

Timeline for d4xroa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xroa1