Lineage for d4xroa1 (4xro A:1-147)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
core: 5 helices; bundleSuperfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) 
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) 
Protein HIV-1 capsid protein [47945] (1 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) 
Domain d4xroa1: 4xro A:1-147 [275064]
Other proteins in same PDB: d4xroa2
automated match to d2m8la1
Details for d4xroa1
PDB Entry: 4xro (more details), 2.01 Å
PDB Description: disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i)
PDB Compounds: (A:) capsid protein p24SCOPe Domain Sequences for d4xroa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xroa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfaalscgatpqdlntmlntvg
ghqaamhmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp
SCOPe Domain Coordinates for d4xroa1:
Click to download the PDB-style file with coordinates for d4xroa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4xroa1:
- d4xroa1 first appeared in SCOPe 2.05
- d4xroa1 appears in SCOPe 2.07
View in 3D
