Lineage for d4xrqa2 (4xrq A:148-219)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1992228Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1992302Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 1992303Protein automated matches [191156] (10 species)
    not a true protein
  7. 1992339Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [273803] (5 PDB entries)
  8. 1992340Domain d4xrqa2: 4xrq A:148-219 [275063]
    Other proteins in same PDB: d4xrqa1
    automated match to d2m8pa2
    complexed with 1b0

Details for d4xrqa2

PDB Entry: 4xrq (more details), 1.95 Å

PDB Description: disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i) in complex with pf-3450074
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4xrqa2:

Sequence, based on SEQRES records: (download)

>d4xrqa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
tsildirqgpkepfrdyidrfyktiraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d4xrqa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
tsildirqgpkepfrdyidrfyktiraeqasqeatetllvqnanpdcktilkalgpgatl
eemmtacq

SCOPe Domain Coordinates for d4xrqa2:

Click to download the PDB-style file with coordinates for d4xrqa2.
(The format of our PDB-style files is described here.)

Timeline for d4xrqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xrqa1