Lineage for d1e3ba_ (1e3b A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416162Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2416168Species Caenorhabditis elegans, isoform 3 [TaxId:6239] [50899] (3 PDB entries)
  8. 2416169Domain d1e3ba_: 1e3b A: [27506]
    complexed with 3ep, au

Details for d1e3ba_

PDB Entry: 1e3b (more details), 1.85 Å

PDB Description: cyclophilin 3 from c.elegans complexed with aup(et)3
PDB Compounds: (A:) cyclophilin 3

SCOPe Domain Sequences for d1e3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ba_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]}
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk

SCOPe Domain Coordinates for d1e3ba_:

Click to download the PDB-style file with coordinates for d1e3ba_.
(The format of our PDB-style files is described here.)

Timeline for d1e3ba_: