Lineage for d4xm4d_ (4xm4 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851929Species Chaetomium thermophilum [TaxId:209285] [275055] (1 PDB entry)
  8. 2851931Domain d4xm4d_: 4xm4 D: [275057]
    automated match to d1kohb_

Details for d4xm4d_

PDB Entry: 4xm4 (more details), 2.95 Å

PDB Description: structure of chaetomium mex67:mtr2 subunits
PDB Compounds: (D:) Mex67

SCOPe Domain Sequences for d4xm4d_:

Sequence, based on SEQRES records: (download)

>d4xm4d_ c.10.2.0 (D:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
tkqkltsclarrynaeqklldlsalgtdetlsslgsfnnqslaeksfkalmhlvsneykd
peqkneaiqavslarndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfl
eelhltgnpvttlpnyateikkwfpslqildgqqirtpqeaaeslks

Sequence, based on observed residues (ATOM records): (download)

>d4xm4d_ c.10.2.0 (D:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
tkqkltsclarrynaeqklldlsalgtdetslaeksfkalmhlvsneykdpeqkneaiqa
vslarndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfleelhltgnpv
ttlpnyateikkwfpslqildgqqirtpqeaaeslks

SCOPe Domain Coordinates for d4xm4d_:

Click to download the PDB-style file with coordinates for d4xm4d_.
(The format of our PDB-style files is described here.)

Timeline for d4xm4d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4xm4c_