SCOPe 2.08: Domain d4xm4d_: 4xm4 D:

Lineage for d4xm4d_ (4xm4 D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [275055] (1 PDB entry)

8. Domain d4xm4d_: 4xm4 D: [275057]
   automated match to d1kohb_

Details for d4xm4d_

PDB Entry: 4xm4, 2.95 Å

PDB Description: structure of chaetomium mex67:mtr2 subunits

PDB Compounds: (D:) Mex67

SCOPe Domain Sequences for d4xm4d_:

Sequence, based on SEQRES records:

>d4xm4d_ c.10.2.0 (D:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
tkqkltsclarrynaeqklldlsalgtdetlsslgsfnnqslaeksfkalmhlvsneykd
peqkneaiqavslarndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfl
eelhltgnpvttlpnyateikkwfpslqildgqqirtpqeaaeslks

Sequence, based on observed residues (ATOM records):

>d4xm4d_ c.10.2.0 (D:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
tkqkltsclarrynaeqklldlsalgtdetslaeksfkalmhlvsneykdpeqkneaiqa
vslarndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfleelhltgnpv
ttlpnyateikkwfpslqildgqqirtpqeaaeslks

Timeline for d4xm4d_:

• d4xm4d_ first appeared in SCOPe 2.05
  
• d4xm4d_ appears in SCOPe 2.07