| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins) automatically mapped to Pfam PF07858 |
| Protein Limonene-1,2-epoxide hydrolase [89855] (1 species) |
| Species Rhodococcus erythropolis [TaxId:1833] [89856] (17 PDB entries) |
| Domain d4xdvf_: 4xdv F: [275051] automated match to d1nu3b_ complexed with 40o; mutant |
PDB Entry: 4xdv (more details), 2.25 Å
SCOPe Domain Sequences for d4xdvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdvf_ d.17.4.8 (F:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
gkitgwrdyfdlrefeeavd
Timeline for d4xdvf_: