Lineage for d4xdvc_ (4xdv C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896654Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
    automatically mapped to Pfam PF07858
  6. 1896655Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)
  7. 1896656Species Rhodococcus erythropolis [TaxId:1833] [89856] (9 PDB entries)
  8. 1896685Domain d4xdvc_: 4xdv C: [275050]
    automated match to d1nu3b_
    complexed with 40o; mutant

Details for d4xdvc_

PDB Entry: 4xdv (more details), 2.25 Å

PDB Description: crystal structure of the l74f/m78v/i80v/l114f mutant of leh complexed with cyclohexanediol
PDB Compounds: (C:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d4xdvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdvc_ d.17.4.8 (C:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
gkitgwrdyfdlrefeeavdlplr

SCOPe Domain Coordinates for d4xdvc_:

Click to download the PDB-style file with coordinates for d4xdvc_.
(The format of our PDB-style files is described here.)

Timeline for d4xdvc_: