SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4xdvc_ (4xdv C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162458Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 protein domains)
    automatically mapped to Pfam PF07858
  6. 2162459Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)
  7. 2162460Species Rhodococcus erythropolis [TaxId:1833] [89856] (13 PDB entries)
  8. 2162489Domain d4xdvc_: 4xdv C: [275050]
    automated match to d1nu3b_
    complexed with 40o; mutant

Details for d4xdvc_

PDB Entry: 4xdv (more details), 2.25 Å

PDB Description: crystal structure of the l74f/m78v/i80v/l114f mutant of leh complexed with cyclohexanediol
PDB Compounds: (C:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d4xdvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdvc_ d.17.4.8 (C:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
ieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppaygr
daveqtlagfftvvsvdavetfhigssnglvytervdvlralptgksynfsilgvfqlte
gkitgwrdyfdlrefeeavdlplr

SCOPe Domain Coordinates for d4xdvc_:

Click to download the PDB-style file with coordinates for d4xdvc_.
(The format of our PDB-style files is described here.)

Timeline for d4xdvc_: