Lineage for d1c5fo_ (1c5f O:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468514Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 468515Superfamily b.62.1: Cyclophilin-like [50891] (2 families) (S)
  5. 468516Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 468527Protein Cyclophilin (eukaryotic) [50893] (9 species)
  7. 468638Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 468648Domain d1c5fo_: 1c5f O: [27504]

Details for d1c5fo_

PDB Entry: 1c5f (more details), 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a

SCOP Domain Sequences for d1c5fo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5fo_ b.62.1.1 (O:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi)}
rrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstfh
rviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqffi
tttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOP Domain Coordinates for d1c5fo_:

Click to download the PDB-style file with coordinates for d1c5fo_.
(The format of our PDB-style files is described here.)

Timeline for d1c5fo_: