Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (21 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [275032] (1 PDB entry) |
Domain d4xb5a2: 4xb5 A:174-314 [275033] Other proteins in same PDB: d4xb5a1 automated match to d1m98a2 complexed with 45d, gol |
PDB Entry: 4xb5 (more details), 1.9 Å
SCOPe Domain Sequences for d4xb5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xb5a2 d.17.4.0 (A:174-314) automated matches {Synechocystis sp. [TaxId: 1111708]} epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln pegkiffvaidllaspkelln
Timeline for d4xb5a2: