SCOPe 2.05: Domain d4xb5a2: 4xb5 A:174-314

Lineage for d4xb5a2 (4xb5 A:174-314)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (21 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [275032] (1 PDB entry)

8. Domain d4xb5a2: 4xb5 A:174-314 [275033]
   Other proteins in same PDB: d4xb5a1
   automated match to d1m98a2
   complexed with 45d, gol

Details for d4xb5a2

PDB Entry: 4xb5, 1.9 Å

PDB Description: structure of orange carotenoid protein binding canthaxanthin

PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d4xb5a2:

Sequence; same for both SEQRES and ATOM records:

>d4xb5a2 d.17.4.0 (A:174-314) automated matches {Synechocystis sp. [TaxId: 1111708]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspkelln

Timeline for d4xb5a2:

• d4xb5a2 is new in SCOPe 2.05-stable
  
• d4xb5a2 appears in SCOPe 2.06
  
• d4xb5a2 appears in the current release, SCOPe 2.08