SCOPe 2.08: Domain d4xbta1: 4xbt A:2-148

Lineage for d4xbta1 (4xbt A:2-148)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
   automatically mapped to Pfam PF07858

6. Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [89856] (17 PDB entries)

8. Domain d4xbta1: 4xbt A:2-148 [275029]
   Other proteins in same PDB: d4xbta2, d4xbtc2
   automated match to d1nu3b_
   complexed with 3zq, flc; mutant

Details for d4xbta1

PDB Entry: 4xbt, 1.7 Å

PDB Description: crystal structure of the l74f/m78f/l103v/l114v/i116v/f139v/l147v mutant of leh complexed with (s,s)-cyclohexanediol

PDB Compounds: (A:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d4xbta1:

Sequence; same for both SEQRES and ATOM records:

>d4xbta1 d.17.4.8 (A:2-148) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
tskieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppa
ygrdaveqtlagfftvfsidavetfhigssnglvytervdvvralptgksynvsvlgvfq
ltegkitgwrdyfdlreveeavdlpvr

Timeline for d4xbta1:

• d4xbta1 first appeared in SCOPe 2.05, called d4xbta_
  
• d4xbta1 appears in SCOPe 2.07