Lineage for d4xbta1 (4xbt A:2-148)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936854Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
    automatically mapped to Pfam PF07858
  6. 2936855Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)
  7. 2936856Species Rhodococcus erythropolis [TaxId:1833] [89856] (17 PDB entries)
  8. 2936866Domain d4xbta1: 4xbt A:2-148 [275029]
    Other proteins in same PDB: d4xbta2, d4xbtc2
    automated match to d1nu3b_
    complexed with 3zq, flc; mutant

Details for d4xbta1

PDB Entry: 4xbt (more details), 1.7 Å

PDB Description: crystal structure of the l74f/m78f/l103v/l114v/i116v/f139v/l147v mutant of leh complexed with (s,s)-cyclohexanediol
PDB Compounds: (A:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d4xbta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xbta1 d.17.4.8 (A:2-148) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
tskieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppa
ygrdaveqtlagfftvfsidavetfhigssnglvytervdvvralptgksynvsvlgvfq
ltegkitgwrdyfdlreveeavdlpvr

SCOPe Domain Coordinates for d4xbta1:

Click to download the PDB-style file with coordinates for d4xbta1.
(The format of our PDB-style files is described here.)

Timeline for d4xbta1: