SCOPe 2.04: Domain d1c5fk_: 1c5f K:

Lineage for d1c5fk_ (1c5f K:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)

8. Domain d1c5fk_: 1c5f K: [27502]

Details for d1c5fk_

PDB Entry: 1c5f, 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a

PDB Compounds: (K:) peptidyl-prolyl cis-trans isomerase 1

SCOPe Domain Sequences for d1c5fk_:

Sequence; same for both SEQRES and ATOM records:

>d1c5fk_ b.62.1.1 (K:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]}
kkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgs
tfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsq
ffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

Timeline for d1c5fk_:

• d1c5fk_ first appeared (with stable ids) in SCOP 1.55
  
• d1c5fk_ appears in SCOPe 2.03
  
• d1c5fk_ appears in SCOPe 2.05
  
• d1c5fk_ appears in the current release, SCOPe 2.08