Lineage for d1c5fk_ (1c5f K:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674496Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 674626Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 674634Domain d1c5fk_: 1c5f K: [27502]

Details for d1c5fk_

PDB Entry: 1c5f (more details), 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a
PDB Compounds: (K:) protein (peptidylprolyl isomerase cyp-1)

SCOP Domain Sequences for d1c5fk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5fk_ b.62.1.1 (K:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]}
kkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgs
tfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsq
ffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOP Domain Coordinates for d1c5fk_:

Click to download the PDB-style file with coordinates for d1c5fk_.
(The format of our PDB-style files is described here.)

Timeline for d1c5fk_: