Lineage for d4wydb_ (4wyd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132697Species Mycobacterium tuberculosis [TaxId:1773] [225404] (27 PDB entries)
  8. 2132699Domain d4wydb_: 4wyd B: [275012]
    automated match to d4cxqa_
    complexed with 3vr, edo, epe, plp

Details for d4wydb_

PDB Entry: 4wyd (more details), 1.35 Å

PDB Description: adenosylmethionine-8-amino-7-oxononanoate aminotransferase from mycobacterium tuberculosis complexed with a fragment from dsf screening
PDB Compounds: (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d4wydb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wydb_ c.67.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqv
fapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrr
yevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtis
agaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavt
dvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsam
vevarlvgsl

SCOPe Domain Coordinates for d4wydb_:

Click to download the PDB-style file with coordinates for d4wydb_.
(The format of our PDB-style files is described here.)

Timeline for d4wydb_: