SCOP 1.75: Domain d1c5fi_: 1c5f I:

Lineage for d1c5fi_ (1c5f I:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (4 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)

8. Domain d1c5fi_: 1c5f I: [27501]

Details for d1c5fi_

PDB Entry: 1c5f, 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a

PDB Compounds: (I:) protein (peptidylprolyl isomerase cyp-1)

SCOP Domain Sequences for d1c5fi_:

Sequence; same for both SEQRES and ATOM records:

>d1c5fi_ b.62.1.1 (I:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]}
drrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstf
hrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqff
itttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

Timeline for d1c5fi_:

• d1c5fi_ first appeared (with stable ids) in SCOP 1.55
  
• d1c5fi_ appears in SCOP 1.73
  
• d1c5fi_ appears in SCOPe 2.01
  
• d1c5fi_ appears in the current release, SCOPe 2.08