| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein (Apo)ferritin [47246] (8 species) |
| Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (52 PDB entries) |
| Domain d3wvua_: 3wvu A: [275006] automated match to d1iera_ complexed with cd, edo, ru, so4 |
PDB Entry: 3wvu (more details), 1.92 Å
SCOPe Domain Sequences for d3wvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wvua_ a.25.1.1 (A:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffcelaeekre
gaerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaq
adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh
Timeline for d3wvua_: