Lineage for d4wwic_ (4wwi C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724803Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1724804Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1724805Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1724826Protein automated matches [191290] (4 species)
    not a true protein
  7. 1724832Species Staphylococcus aureus [TaxId:1280] [189943] (13 PDB entries)
  8. 1724848Domain d4wwic_: 4wwi C: [275003]
    automated match to d4npda_

Details for d4wwic_

PDB Entry: 4wwi (more details), 2.31 Å

PDB Description: crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
PDB Compounds: (C:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d4wwic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwic_ a.8.1.1 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kfnkeqqnafyeilhlpnlteeqrngfiqslkddpsvskeilaeakklndaqapk

SCOPe Domain Coordinates for d4wwic_:

Click to download the PDB-style file with coordinates for d4wwic_.
(The format of our PDB-style files is described here.)

Timeline for d4wwic_: