SCOPe 2.07: Domain d4wvfb_: 4wvf B:

Lineage for d4wvfb_ (4wvf B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (62 PDB entries)

8. Domain d4wvfb_: 4wvf B: [275000]
   Other proteins in same PDB: d4wvfa_
   automated match to d4hawb_
   complexed with cl, edo, gnp, gol, k76, mg

Details for d4wvfb_

PDB Entry: 4wvf, 1.8 Å

PDB Description: crystal structure of kpt276 in complex with crm1-ran-ranbp1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d4wvfb_:

Sequence, based on SEQRES records:

>d4wvfb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkv
rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske
nadkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records):

>d4wvfb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvtmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
fekaqeinkk

Timeline for d4wvfb_:

• d4wvfb_ first appeared in SCOPe 2.05
  
• d4wvfb_ appears in SCOPe 2.06
  
• d4wvfb_ appears in the current release, SCOPe 2.08