Class b: All beta proteins [48724] (177 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein Cyclophilin (eukaryotic) [50893] (13 species) |
Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries) |
Domain d1c5fg_: 1c5f G: [27500] |
PDB Entry: 1c5f (more details), 2.47 Å
SCOPe Domain Sequences for d1c5fg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5fg_ b.62.1.1 (G:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} rrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstfh rviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqffi tttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
Timeline for d1c5fg_: