Lineage for d1c5fg_ (1c5f G:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62537Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 62538Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 62539Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 62545Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 62628Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 62634Domain d1c5fg_: 1c5f G: [27500]

Details for d1c5fg_

PDB Entry: 1c5f (more details), 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a

SCOP Domain Sequences for d1c5fg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5fg_ b.62.1.1 (G:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi)}
rrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstfh
rviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqffi
tttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOP Domain Coordinates for d1c5fg_:

Click to download the PDB-style file with coordinates for d1c5fg_.
(The format of our PDB-style files is described here.)

Timeline for d1c5fg_: