Lineage for d1c5fg_ (1c5f G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806648Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2806873Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 2806879Domain d1c5fg_: 1c5f G: [27500]

Details for d1c5fg_

PDB Entry: 1c5f (more details), 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a
PDB Compounds: (G:) peptidyl-prolyl cis-trans isomerase 1

SCOPe Domain Sequences for d1c5fg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5fg_ b.62.1.1 (G:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]}
rrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstfh
rviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqffi
tttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOPe Domain Coordinates for d1c5fg_:

Click to download the PDB-style file with coordinates for d1c5fg_.
(The format of our PDB-style files is described here.)

Timeline for d1c5fg_: