Lineage for d4ws7a_ (4ws7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114317Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2114318Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2114425Family c.18.1.0: automated matches [193165] (1 protein)
    not a true family
  6. 2114426Protein automated matches [193166] (6 species)
    not a true protein
  7. 2114434Species Mycobacterium tuberculosis [TaxId:83332] [231763] (19 PDB entries)
  8. 2114450Domain d4ws7a_: 4ws7 A: [274996]
    automated match to d3a7na_
    protein/DNA complex; complexed with 5uc, cl, edo

Details for d4ws7a_

PDB Entry: 4ws7 (more details), 1.88 Å

PDB Description: crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with 5-chlorouracil, form ii
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4ws7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ws7a_ c.18.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rplselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraftfpfdnvrvl
ivgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngdltpwaqrgv
lllnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdastlkpmlaagn
cvaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp

SCOPe Domain Coordinates for d4ws7a_:

Click to download the PDB-style file with coordinates for d4ws7a_.
(The format of our PDB-style files is described here.)

Timeline for d4ws7a_: