Lineage for d4wrva_ (4wrv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855129Family c.18.1.0: automated matches [193165] (1 protein)
    not a true family
  6. 2855130Protein automated matches [193166] (6 species)
    not a true protein
  7. 2855138Species Mycobacterium tuberculosis [TaxId:83332] [231763] (19 PDB entries)
  8. 2855152Domain d4wrva_: 4wrv A: [274987]
    automated match to d3a7na_
    protein/DNA complex; complexed with cl, ura

Details for d4wrva_

PDB Entry: 4wrv (more details), 1.44 Å

PDB Description: crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with uracil, form iii
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4wrva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wrva_ c.18.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
plselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraftfpfdnvrvli
vgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngdltpwaqrgvl
llnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdastlkpmlaagnc
vaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp

SCOPe Domain Coordinates for d4wrva_:

Click to download the PDB-style file with coordinates for d4wrva_.
(The format of our PDB-style files is described here.)

Timeline for d4wrva_: