| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
| Family c.18.1.0: automated matches [193165] (1 protein) not a true family |
| Protein automated matches [193166] (6 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [231763] (19 PDB entries) |
| Domain d4wrua_: 4wru A: [274982] automated match to d3a7na_ protein/DNA complex; complexed with cl, gol, ura |
PDB Entry: 4wru (more details), 1.24 Å
SCOPe Domain Sequences for d4wrua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wrua_ c.18.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rplselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraftfpfdnvrvl
ivgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngdltpwaqrgv
lllnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdastlkpmlaagn
cvaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp
Timeline for d4wrua_: