SCOPe 2.06: Domain d4wrxa1: 4wrx A:1-227

Lineage for d4wrxa1 (4wrx A:1-227)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.0: automated matches [193165] (1 protein)
   not a true family

6. Protein automated matches [193166] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [231763] (19 PDB entries)

8. Domain d4wrxa1: 4wrx A:1-227 [274981]
   Other proteins in same PDB: d4wrxa2
   automated match to d3a7na_
   complexed with cl

Details for d4wrxa1

PDB Entry: 4wrx, 1.4 Å

PDB Description: crystal structure of mycobacterium tuberculosis uracil-dna glycosylase, form v

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4wrxa1:

Sequence; same for both SEQRES and ATOM records:

>d4wrxa1 c.18.1.0 (A:1-227) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtarplselvergwaaalepvadqvahmgqflraeiaagrrylpagsnvlraftfpfdnv
rvlivgqdpyptpghavglsfsvapdvrpwprslanifdeytadlgyplpsngdltpwaq
rgvlllnrvltvrpsnpashrgkgweavtecairalaaraaplvailwgrdastlkpmla
agncvaiesphpsplsasrgffgsrpfsranellvgmgaepidwrlp

Timeline for d4wrxa1:

• d4wrxa1 first appeared in SCOPe 2.05, called d4wrxa_
  
• d4wrxa1 appears in SCOPe 2.07
  
• d4wrxa1 appears in the current release, SCOPe 2.08