Lineage for d1c5fc_ (1c5f C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801476Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1801477Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1801478Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1801479Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1801643Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 1801647Domain d1c5fc_: 1c5f C: [27498]

Details for d1c5fc_

PDB Entry: 1c5f (more details), 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a
PDB Compounds: (C:) peptidyl-prolyl cis-trans isomerase 1

SCOPe Domain Sequences for d1c5fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5fc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]}
mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOPe Domain Coordinates for d1c5fc_:

Click to download the PDB-style file with coordinates for d1c5fc_.
(The format of our PDB-style files is described here.)

Timeline for d1c5fc_: